Reaction Details |
| Report a problem with these data |
Target | P2X purinoceptor 3 |
---|
Ligand | BDBM320052 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Intracellular Calcium Measurement to Assess Antagonist Activity at Human P2X3 and Human P2X2/3 Receptors |
---|
IC50 | 2.00±n/a nM |
---|
Citation | Davenport, AJ; Bräuer, N; Fischer, OM; Rotgeri, A; Rottmann, A; Neagoe, I; Nagel, J; Godinho-Coelho, A; Klar, J 1,3-thiazol-2-yl substituted benzamides US Patent US10183937 Publication Date 1/22/2019 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
P2X purinoceptor 3 |
---|
Name: | P2X purinoceptor 3 |
Synonyms: | ATP receptor | Glucocorticoid receptor | P2RX3 | P2RX3_HUMAN | P2X purinoceptor 3 | P2X purinoceptor 3 (P2RX3) | P2X purinoceptor 3 (P2X3) | P2X3 | P2X3 purinoceptor | Purinergic receptor | p2x3 + hsa |
Type: | Protein |
Mol. Mass.: | 44292.02 |
Organism: | Homo sapiens (Human) |
Description: | P56373 |
Residue: | 397 |
Sequence: | MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDS
QCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVETPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADQYKAKKFEE
VNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH
|
|
|
BDBM320052 |
---|
n/a |
---|
Name | BDBM320052 |
Synonyms: | 3-{[(4aS,7S, 7aR)-4- methylocta- hydro- cyclopenta[b] [1,4]oxazin- 7-yl]oxy}-5- (5-methyl-1,3- thiazol-2-yl)-N- {(1R)-1-[2- (trifluoromethyl) pyrimidin-5- yl]ethyl} benzamide | US10174016, Example 219 | US10202369, Example 219 | US10472354, Example 219 |
Type | Small organic molecule |
Emp. Form. | C26H28F3N5O3S |
Mol. Mass. | 547.592 |
SMILES | C[C@@H](NC(=O)c1cc(O[C@H]2CC[C@H]3[C@H]2OCCN3C)cc(c1)-c1ncc(C)s1)c1cnc(nc1)C(F)(F)F |r| |
Structure |
|