Reaction Details |
| Report a problem with these data |
Target | Arachidonate 5-lipoxygenase-activating protein |
---|
Ligand | BDBM323066 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | FLAP Binding Assay (Test A) |
---|
IC50 | 44.0±n/a nM |
---|
Citation | Broddefalk, JO; Emtenäs, HF; Granberg, KL; Lemurell, MA; Pettersen, DT; Plowright, AT; Ulander, LJ Pyrazole derivatives useful as 5-lipoxygenase activating protein (FLAP) inhibitors US Patent US10183947 Publication Date 1/22/2019 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Arachidonate 5-lipoxygenase-activating protein |
---|
Name: | Arachidonate 5-lipoxygenase-activating protein |
Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | 5-lipoxygenase/FLAP | AL5AP_HUMAN | ALOX5AP | FLAP | MK-886-binding protein |
Type: | Enzyme |
Mol. Mass.: | 18159.90 |
Organism: | Homo sapiens (Human) |
Description: | P20292 |
Residue: | 161 |
Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
BDBM323066 |
---|
n/a |
---|
Name | BDBM323066 |
Synonyms: | (1R,2R and 1S,1S)-N-(4-Cyano-3-methyl- 1,2-thiazol-5-yl)-2-[4-(1H-pyrazol-5- yl)benzoyl]cyclohexanecarboxamide | US10183947, Example 49 | US10508119, Example 49 |
Type | Small organic molecule |
Emp. Form. | C22H21N5O2S |
Mol. Mass. | 419.499 |
SMILES | Cc1nsc(NC(=O)C2CCCCC2C(=O)c2ccc(cc2)-c2ccn[nH]2)c1C#N |w:8.7,13.14| |
Structure |
|