Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDiacylglycerol O-acyltransferase 2
LigandBDBM323662
Substrate/Competitorn/a
Meas. Tech.In Vitro DGAT2 Assay
IC50 7.90±n/a nM
Citation Futatsugi K Diacylglycerol acyltransferase 2 inhibitors US Patent  US10188653 Publication Date 1/29/2019
More Info.:Get all data from this article,  Assay Method
 
Diacylglycerol O-acyltransferase 2
Name:Diacylglycerol O-acyltransferase 2
Synonyms:ARAT | Acyl-CoA retinol O-fatty-acyltransferase | DGAT2 | Diacylglycerol O-acyltransferase 2 (DGAT2) | Diglyceride acyltransferase 2 | Retinol O-fatty-acyltransferase
Type:Multi-pass membrane protein
Mol. Mass.:43848.90
Organism:Homo sapiens (Human)
Description:Q96PD7
Residue:388
Sequence:
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLN
RSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKG
GRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATE
VSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGG
AAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQ
KKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHT
MYMEALVKLFDKHKTKFGLPETEVLEVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM323662
n/a
NameBDBM323662
Synonyms:(R)-(3,3-difluoroazetidin- 1-yl)(2-(3-(2- ethoxyphenoxy)piperidin- 1-yl)pyrimidin-5- yl)methanone | US10188653, Example 20.7 | US9789110, 20.7
TypeSmall organic molecule
Emp. Form.C21H24F2N4O3
Mol. Mass.418.4371
SMILESCCOc1ccccc1O[C@@H]1CCCN(C1)c1ncc(cn1)C(=O)N1CC(F)(F)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: