Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetB-Raf (V600E)
LigandBDBM190858
Substrate/Competitorn/a
Meas. Tech.Raf IC50 Assay
Temperature298.15±n/a K
IC50 3000±n/a nM
Commentsextracted
Citation Zhou CZhang G Fused tricyclic urea compounds as Raf kinase and/or Raf kinase dimer inhibitors US Patent  US9670203 Publication Date 6/6/2017  Article
More Info.:Get all data from this article,  Assay Method
 
B-Raf (V600E)
Name:B-Raf (V600E)
Synonyms:n/a
Type:n/a
Mol. Mass.:39690.71
Organism:Homo sapiens (Human)
Description:PV3849, from Invitrogen
Residue:351
Sequence:
LQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGK
WHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGS
SLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDF
GLATEKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLP
YSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIE
LLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM190858
n/a
NameBDBM190858
Synonyms:US9670203, Compound 1.71 1-((1R,1aR,6bR)-5-((7-oxo-5,6,7,8-tetrahydro-1,8-naphthyridin-4-yl)oxy)-1a,6b-dihydro-1H-cyclopropa[b]benzofuran-1-yl)-3-(3-(trifluoromethyl)phenyl)urea
TypeSmall organic molecule
Emp. Form.C25H19F3N4O4
Mol. Mass.496.438
SMILESFC(F)(F)c1cccc(NC(=O)N[C@H]2[C@@H]3Oc4ccc(Oc5ccnc6NC(=O)CCc56)cc4[C@H]23)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: