Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-Raf (Y340D/Y341D)
LigandBDBM50396483
Substrate/Competitorn/a
Meas. Tech.Raf IC50 Assay
Temperature298.15±n/a K
IC50 31000±n/a nM
Commentsextracted
Citation Zhou CZhang G Fused tricyclic urea compounds as Raf kinase and/or Raf kinase dimer inhibitors US Patent  US9670203 Publication Date 6/6/2017  Article
More Info.:Get all data from this article,  Assay Method
 
C-Raf (Y340D/Y341D)
Name:C-Raf (Y340D/Y341D)
Synonyms:n/a
Type:n/a
Mol. Mass.:38958.87
Organism:Homo sapiens (Human)
Description:PV3805, from Invitrogen
Residue:343
Sequence:
SQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSDDWEIEASEVMLSTRIGSGSFGTVYK
GKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCE
GSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIG
DFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGE
LPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFPQILSS
IELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50396483
n/a
NameBDBM50396483
Synonyms:PLX-4032 | RG 7204 | Ro 5185426 | US9388165, Reference, Vemurafenib (PLX-4032) | VEMURAFENIB
TypeSmall organic molecule
Emp. Form.C23H18ClF2N3O3S
Mol. Mass.489.922
SMILESCCCS(=O)(=O)Nc1ccc(F)c(C(=O)c2c[nH]c3ncc(cc23)-c2ccc(Cl)cc2)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: