Reaction Details |
| Report a problem with these data |
Target | Capsid protein |
---|
Ligand | BDBM324422 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | BDNA-assay |
---|
EC50 | <100±n/a nM |
---|
Citation | Hartman, GD; Kuduk, S Derivatives and methods of treating hepatitis B infections US Patent US10189835 Publication Date 1/29/2019 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Capsid protein |
---|
Name: | Capsid protein |
Synonyms: | C | CAPSD_HBVCJ | Core antigen | Core protein | HBcAg | p21.5 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 21105.01 |
Organism: | Hepatitis B virus genotype C subtype ayr (isolate Human/Japan/Okamoto/-) (HBV-C) |
Description: | n/a |
Residue: | 183 |
Sequence: | MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIL
CWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
SFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRE
SQC
|
|
|
BDBM324422 |
---|
n/a |
---|
Name | BDBM324422 |
Synonyms: | US10189835, Compound 698 |
Type | Small organic molecule |
Emp. Form. | C17H17ClFN5O3 |
Mol. Mass. | 393.8 |
SMILES | FC1CON(C1)C(=O)c1n[nH]c2CCN(Cc12)C(=O)Nc1cccc(Cl)c1 |
Structure |
|