Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase IV
LigandBDBM11616
Substrate/CompetitorBDBM10856
Meas. Tech.CA Inhibition Assay
Ki 4.0±n/a nM
Citation Ilies MAVullo DPastorek JScozzafava AIlies MCaproiu MTPastorekova SSupuran CT Carbonic anhydrase inhibitors. Inhibition of tumor-associated isozyme IX by halogenosulfanilamide and halogenophenylaminobenzolamide derivatives. J Med Chem 46:2187-96 (2003) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carbonic Anhydrase IV
Name:Carbonic anhydrase
Synonyms:CA-IV | Carbonate dehydratase IV | Carbonic anhydrase 4
Type:Enzyme
Mol. Mass.:35152.74
Organism:Bos taurus (bovine)
Description:Bovine isozyme, isolated from lung microsomes
Residue:312
Sequence:
MRLLLALLVLAAAPPQARAASHWCYQIQVKPSNYTCLEPDEWEGSCQNNRQSPVNIVTAK
TQLDPNLGRFSFSGYNMKHQWVVQNNGHTVMVLLENKPSIAGGGLSTRYQATQLHLHWSR
AMDRGSEHSFDGERFAMEMHIVHEKEKGLSGNASQNQFAEDEIAVLAFMVEDGSKNVNFQ
PLVEALSDIPRPNMNTTMKEGVSLFDLLPEEESLRHYFRYLGSLTTPTCDEKVVWTVFQK
PIQLHRDQILAFSQKLFYDDQQKVNMTDNVRPVQSLGQRQVFRSGAPGLLLAQPLPTLLA
PVLACLTVGFLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11616
BDBM10856
NameBDBM11616
Synonyms:5-(4-Acetamido-3-fluorobenzenesulfonamido)-1,3,4-thiadiazole-2-sulfonamide | N-{2-fluoro-4-[(5-sulfamoyl-1,3,4-thiadiazol-2-yl)sulfamoyl]phenyl}acetamide | aminobenzolamide 16b | aminobenzolamide deriv. 40
TypeSmall organic molecule
Emp. Form.C10H10FN5O5S3
Mol. Mass.395.41
SMILESCC(=O)Nc1ccc(cc1F)S(=O)(=O)Nc1nnc(s1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: