Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDipeptidyl peptidase IV
LigandBDBM11645
Substrate/CompetitorBDBM11057
Meas. Tech.DPP Inhibition Assay
pH7.5±n/a
Temperature295.15±n/a K
Ki 3±n/a nM
Citation Longenecker KLStewart KDMadar DJJakob CGFry EHWilk SLin CWBallaron SJStashko MALubben THYong HPireh DPei ZBasha FWiedeman PEvon Geldern TWTrevillyan JMStoll VS Crystal structures of DPP-IV (CD26) from rat kidney exhibit flexible accommodation of peptidase-selective inhibitors. Biochemistry 45:7474-82 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dipeptidyl peptidase IV
Name:Dipeptidyl peptidase IV
Synonyms:Bile canaliculus domain-specific membrane glycoprotein | CD_antigen=CD26 | DPP IV | Dipeptidyl Peptidase IV (DPP-IV) | Dipeptidyl peptidase 4 | Dipeptidyl peptidase 4 (DDPIV) | Dipeptidyl peptidase 4 60 kDa soluble form | Dipeptidyl peptidase 4 membrane form | Dipeptidyl peptidase 4 soluble form | Dipeptidyl peptidase IV 60 kDa soluble form | Dipeptidyl peptidase IV membrane form | Dipeptidyl peptidase IV soluble form | GP110 glycoprotein | T-cell activation antigen CD26
Type:Enzyme
Mol. Mass.:88084.94
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:767
Sequence:
MKTPWKVLLGLLGVAALVTIITVPVVLLNKDEAAADSRRTYTLADYLKNTFRVKSYSLRW
VSDSEYLYKQENNILLFNAEHGNSSIFLENSTFEIFGDSISDYSVSPDRLFVLLEYNYVK
QWRHSYTASYSIYDLNKRQLITEEKIPNNTQWITWSQEGHKLAYVWKNDIYVKIEPHLPS
HRITSTGKENVIFNGINDWVYEEEIFGAYSALWWSPNGTFLAYAQFNDTGVPLIEYSFYS
DESLQYPKTVWIPYPKAGAVNPTVKFFIVNTDSLSSTTTTIPMQITAPASVTTGDHYLCD
VAWVSEDRISLQWLRRIQNYSVMAICDYDKTTLVWNCPTTQEHIETSATGWCGRFRPAEP
HFTSDGSSFYKIVSDKDGYKHICQFQKDRKPEQVCTFITKGAWEVISIEALTSDYLYYIS
NEYKEMPGGRNLYKIQLTDHTNKKCLSCDLNPERCQYYSVSLSKEAKYYQLGCRGPGLPL
YTLHRSTDQKELRVLEDNSALDKMLQDVQMPSKKLDFIVLNETRFWYQMILPPHFDKSKK
YPLLIDVYAGPCSQKADAAFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINKRLG
TLEVEDQIEAARQFLKMGFVDSKRVAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRW
EYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQI
SKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11645
BDBM11057
NameBDBM11645
Synonyms:2-{[8-(3-aminopiperidin-1-yl)-1,3-dimethyl-2,6-dioxo-2,3,6,7-tetrahydro-1H-purin-7-yl]methyl}benzonitrile | Xanthine Analogue 4 | Xanthine mimetic compound 6
TypeSmall organic molecule
Emp. Form.C20H23N7O2
Mol. Mass.393.4423
SMILESCn1c2nc(N3CCCC(N)C3)n(Cc3ccccc3C#N)c2c(=O)n(C)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: