| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ubiquitin-conjugating enzyme E2 E1 |
|---|
| Ligand | BDBM329904 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | HTRF Assay |
|---|
| IC50 | <10±n/a nM |
|---|
| Citation |  Afroze, R; Bharathan, IT; Ciavarri, JP; Fleming, PE; Gaulin, JL; Girard, M; Langston, SP; Soucy, F; Wong, T; Ye, Y Pyrazolopyrimidinyl inhibitors of ubiquitin-activating enzyme US Patent US9663525 Publication Date 5/30/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ubiquitin-conjugating enzyme E2 E1 |
|---|
| Name: | Ubiquitin-conjugating enzyme E2 E1 |
|---|
| Synonyms: | E2 ubiquitin-conjugating enzyme E1 | UB2E1_HUMAN | UBCH6 | UBE2E1 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 21408.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P51965 |
|---|
| Residue: | 193 |
|---|
| Sequence: | MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADIT
LDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIY
HCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEH
DRMARQWTKRYAT
|
|
|
|---|
| BDBM329904 |
|---|
| n/a |
|---|
| Name | BDBM329904 |
|---|
| Synonyms: | (s.e.)-((1R,2R,3S,4R)-4-(2-(4-(difluoromethoxy)naphthalen-1-yl)pyrazolo[1,5- | US10202389, Compound I-112 | US9663525, Compound I-112 | US9796725, Compound I-112 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H23F2N5O6S |
|---|
| Mol. Mass. | 535.52 |
|---|
| SMILES | NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(nn23)-c2ccc(OC(F)F)c3ccccc23)[C@H](O)[C@@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
