Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase II Mutant (F131V)
LigandBDBM12014
Substrate/CompetitorBDBM11402
Meas. Tech.In vitro binding of inhibitor to hCA-II
pH7.4±n/a
Temperature310.15±n/a K
Kd 2.3±n/a nM
Citation Kim CYChandra PPJain AChristianson DW Fluoroaromatic-fluoroaromatic interactions between inhibitors bound in the crystal lattice of human carbonic anhydrase II. J Am Chem Soc 123:9620-7 (2001) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carbonic Anhydrase II Mutant (F131V)
Name:Carbonic Anhydrase II Mutant (F131V)
Synonyms:CA-II | Carbonate dehydratase II | Carbonic anhydrase C
Type:Enzyme
Mol. Mass.:29071.47
Organism:Homo sapiens (Human)
Description:n/a
Residue:259
Sequence:
SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILN
NGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLV
HWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPR
GLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMV
DNWRPAQPLKNRQIKASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM12014
BDBM11402
NameBDBM12014
Synonyms:2-fluoro-SBB | 4-(AMINOSULFONYL)-N-[(2-FLUOROPHENYL)METHYL]-BENZAMIDE | N-[(2-fluorophenyl)methyl]-4-sulfamoylbenzamide
TypeSmall organic molecule
Emp. Form.C14H13FN2O3S
Mol. Mass.308.328
SMILESNS(=O)(=O)c1ccc(cc1)C(=O)NCc1ccccc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: