| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM312203 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Receptor Assay |
|---|
| Ki | 0.660±0.08 nM |
|---|
| Citation |  McCurdy, CR; Mesangeau, C; Chin, FT; James, ML; Shen, B; Gambhir, S; Biswal, S; Behera, D Highly selective sigma receptor ligands and radioligands as probes in nociceptive processing and the pathphysiological study of memory deficits and cognitive disorders US Patent US9724435 Publication Date 8/8/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20953.88 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q5U3Y7 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
|---|
| BDBM312203 |
|---|
| n/a |
|---|
| Name | BDBM312203 |
|---|
| Synonyms: | US9604926, Compound CM-401 | US9724435, Compound CM-401 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H25FN2O3 |
|---|
| Mol. Mass. | 408.4653 |
|---|
| SMILES | CC(=O)c1ccc2n(CCCCN3CCC(=CC3)c3ccc(F)cc3)c(=O)oc2c1 |c:15| |
|---|
| Structure | 
|
|---|
Search and Browse
