Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFalcipain-2
LigandBDBM12038
Substrate/CompetitorBDBM12033
Meas. Tech.Falcipain Enzyme Inhibition Assay
pH5.5±n/a
Temperature295.15±n/a K
IC50 3800±n/a nM
Citation Dominguez JNLeon CRodrigues JGamboa de Dominguez NGut JRosenthal PJ Synthesis and evaluation of new antimalarial phenylurenyl chalcone derivatives. J Med Chem 48:3654-8 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Falcipain-2
Name:Falcipain-2
Synonyms:n/a
Type:Enzyme
Mol. Mass.:55912.57
Organism:Plasmodium falciparum
Description:n/a
Residue:484
Sequence:
MDYNMDYAPHEVISQQGERFVDKYVDRKILKNKKSLLVIISLSVLSVVGFVLFYFTPNSR
KSDLFKNSSVENNNDDYIINSLLKSPNGKKFIVSKIDEALSFYDSKKNDINKYNEGNNNN
NADFKGLSLFKENTPSNNFIHNKDYFINFFDNKFLMNNAEHINQFYMFIKTNNKQYNSPN
EMKERFQVFLQNAHKVNMHNNNKNSLYKKELNRFADLTYHEFKNKYLSLRSSKPLKNSKY
LLDQMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAI
RKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNID
RCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDELNHAVM
LVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFI
PLIE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM12038
BDBM12033
NameBDBM12038
Synonyms:3-(4-chlorophenyl)-1-{4-[(2E)-3-phenylprop-2-enoyl]phenyl}urea | Phenylurenyl Chalcone deriv. 28
TypeSmall organic molecule
Emp. Form.C22H17ClN2O2
Mol. Mass.376.836
SMILESClc1ccc(NC(=O)Nc2ccc(cc2)C(=O)\C=C\c2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: