Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCoagulation factor IX
LigandBDBM12773
Substrate/CompetitorBDBM12774
Meas. Tech.Enzyme Assay and Determination of the Inhibition Constants.
Ki 15±n/a nM
Citation Smallheer JMAlexander RSWang JWang SNakajima SRossi KASmallwood ABarbera FBurdick DLuettgen JMKnabb RMWexler RRJadhav PK SAR and factor IXa crystal structure of a dual inhibitor of factors IXa and Xa. Bioorg Med Chem Lett 14:5263-7 (2004) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Coagulation factor IX
Name:Coagulation factor IX
Synonyms:Christmas factor | Coagulation factor IX precursor | Coagulation factor IXa | Coagulation factor IXa heavy chain | Coagulation factor IXa light chain | Factor IX | Factor IXa | Factor IXa (fIXa) | PTC | Plasma thromboplastin component
Type:Enzyme
Mol. Mass.:51768.83
Organism:Homo sapiens (Human)
Description:n/a
Residue:461
Sequence:
MQRVNMIMAESPGLITICLLGYLLSAECTVFLDHENANKILNRPKRYNSGKLEEFVQGNL
ERECMEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGGSCKDDINSYECWCP
FGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGR
VSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFPW
QVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEETEHTEQKRNVIRII
PHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFLKFGSGYVSGWGRVF
HKGRSALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGGRDSCQGDSGGPHVTEVE
GTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM12773
BDBM12774
NameBDBM12773
Synonyms:1-(3-carbamimidoylphenyl)-N-[4-(5-chloro-1H-1,3-benzodiazol-1-yl)phenyl]-3-(pyridin-3-yl)-1H-pyrazole-5-carboxamide | pyrazole analog 8f
TypeSmall organic molecule
Emp. Form.C29H21ClN8O
Mol. Mass.532.983
SMILESNC(=N)c1cccc(c1)-n1nc(cc1C(=O)Nc1ccc(cc1)-n1cnc2cc(Cl)ccc12)-c1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: