Reaction Details |
| Report a problem with these data |
Target | Phenylethanolamine N-methyltransferase |
---|
Ligand | BDBM13016 |
---|
Substrate/Competitor | BDBM13015 |
---|
Meas. Tech. | Radiochemical Assay of PNMT Inhibitors |
---|
pH | 8±n/a |
---|
Temperature | 310.15±n/a K |
---|
Ki | 5800±500 nM |
---|
Citation | Grunewald, GL; Seim, MR; Regier, RC; Martin, JL; Gee, CL; Drinkwater, N; Criscione, KR Comparison of the binding of 3-fluoromethyl-7-sulfonyl-1,2,3,4-tetrahydroisoquinolines with their isosteric sulfonamides to the active site of phenylethanolamine N-methyltransferase. J Med Chem49:5424-33 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Phenylethanolamine N-methyltransferase |
---|
Name: | Phenylethanolamine N-methyltransferase |
Synonyms: | Noradrenaline N-methyltransferase | PENT | PNMT | PNMT_HUMAN | PNMTase | Phenylethanolamine N-Methyltransferase (PNMT) |
Type: | Enzyme |
Mol. Mass.: | 30852.66 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 282 |
Sequence: | MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRC
LAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGA
FNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVS
AFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVR
EALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL
|
|
|
BDBM13016 |
---|
BDBM13015 |
---|
Name | BDBM13016 |
Synonyms: | 1,2,3,4-tetrahydroisoquinoline | CHEMBL14346 | THIQ 6 | tetrahydroisoquinoline |
Type | Small organic molecule |
Emp. Form. | C9H11N |
Mol. Mass. | 133.1903 |
SMILES | C1Cc2ccccc2CN1 |
Structure |
|