Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFlap endonuclease 1
LigandBDBM335640
Substrate/Competitorn/a
Meas. Tech.Binding Assay
Ki 1.30±n/a nM
Citation Eccles WFitzgerald AEHack MDHawryluk NAJones WMKeith JMKrawczuk PLebsack ADLiu JMani NSMcClure KJMeduna SPRosen MD FLAP modulators US Patent  US9732093 Publication Date 8/15/2017
More Info.:Get all data from this article,  Assay Method
 
Flap endonuclease 1
Name:Flap endonuclease 1
Synonyms:DNase IV | FEN-1 | FEN1 | Flap structure-specific endonuclease 1 | MF1 | Maturation factor 1 | RAD2 | hFEN-1
Type:PROTEIN
Mol. Mass.:42602.57
Organism:Homo sapiens (Human)
Description:ChEMBL_1517026
Residue:380
Sequence:
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGET
TSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAE
QEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDM
DCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRG
IGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSE
PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEP
KGSTKKKAKTGAAGKFKRGK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM335640
n/a
NameBDBM335640
Synonyms:US9732093, Compound 149 | tert-Butyl [2-({2-[3-(5-aminopyrazin-2- yl)-6-cyclobutyl-2- fluorophenoxy]pyrimidin-4- yl}amino)ethyl]carbamate
TypeSmall organic molecule
Emp. Form.C25H30FN7O3
Mol. Mass.495.5492
SMILESCC(C)(C)OC(=O)NCCNc1cc(Oc2c(F)c(ccc2C2CCC2)-c2cnc(N)cn2)ncn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: