Reaction Details |
| Report a problem with these data |
Target | Geranylgeranyl transferase type-1 subunit beta |
---|
Ligand | BDBM13390 |
---|
Substrate/Competitor | K-ras(B) decapeptide |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
IC50 | 1800±n/a nM |
---|
Citation | Wang, L; Wang, GT; Wang, X; Tong, Y; Sullivan, G; Park, D; Leonard, NM; Li, Q; Cohen, J; Gu, WZ; Zhang, H; Bauch, JL; Jakob, CG; Hutchins, CW; Stoll, VS; Marsh, K; Rosenberg, SH; Sham, HL; Lin, NH Design, synthesis, and biological activity of 4-[(4-cyano-2-arylbenzyloxy)-(3-methyl-3H-imidazol-4-yl)methyl]benzonitriles as potent and selective farnesyltransferase inhibitors. J Med Chem47:612-26 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Geranylgeranyl transferase type-1 subunit beta |
---|
Name: | Geranylgeranyl transferase type-1 subunit beta |
Synonyms: | GGTase-I-beta | Geranylgeranyl transferase type I | Geranylgeranyl transferase type-1 subunit beta | PGGT1B | PGTB1_BOVIN | Type I protein geranyl-geranyltransferase subunit beta |
Type: | Enzyme |
Mol. Mass.: | 42483.88 |
Organism: | Bos taurus (bovine) |
Description: | Purified from bovine brain |
Residue: | 377 |
Sequence: | MAATEDERPTGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDM
LDSLDVVNKDDIIEWIYSLQVLPTEDRSNLNRCGFRGSSYLGIPFNPSKNPGTAHPYDSG
HIAMTYTGLSCLVILGDDLSRVNKEACLAGLRALQLEDGSFCAVPEGSENDMRFVYCASC
ICYMLNNWSGMDMKKAINYIRRSMSYDNGLAQGAGLESHGGSTFCGIASLCLMGKLEEVF
SEKELNRIKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATLKLLKIFQYTNFEKNRNYILS
TQDRLVGGFAKWPDSHPDALHAYFGICGLSLMEESGICKVHPALNVSTRTSERLRDLHQS
WKTKDSKQCSENVHIST
|
|
|
BDBM13390 |
---|
K-ras(B) decapeptide |
---|
Name: | K-ras(B) decapeptide |
Synonyms: | biotin conjugated K-ras decapeptide |
Type: | Peptide |
Mol. Mass.: | 1611.07 |
Organism: | n/a |
Description: | n/a |
Residue: | 14 |
Sequence: | |