Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntermediate conductance calcium-activated potassium channel protein 4
LigandBDBM200942
Substrate/Competitorn/a
Meas. Tech.KCa3.1 Assay
IC50 52±0 nM
Citation Burke MJMcKibben BTschantz MA Fused thiazin-3-ones as KCA3.1 inhibitors US Patent  US9533999 Publication Date 1/3/2017
More Info.:Get all data from this article,  Assay Method
 
Intermediate conductance calcium-activated potassium channel protein 4
Name:Intermediate conductance calcium-activated potassium channel protein 4
Synonyms:IK1 | IKCa1 | KCa4 | Putative Gardos channel | SK4
Type:PROTEIN
Mol. Mass.:47723.22
Organism:Homo sapiens (Human)
Description:ChEMBL_1361891
Residue:427
Sequence:
MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFL
VKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPA
PVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR
SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDT
LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
LREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP
EPSQQSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM200942
n/a
NameBDBM200942
Synonyms:US9533999, ii-7
TypeSmall organic molecule
Emp. Form.C15H10ClF3N2OS2
Mol. Mass.390.831
SMILESFC(F)(F)Sc1cc(CN2C(=O)CSc3cccnc23)ccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: