Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFlap endonuclease 1
LigandBDBM337603
Substrate/Competitorn/a
Meas. Tech.Binding Assay
Ki 0.700±n/a nM
Citation Bacani GMEccles WFitzgerald AEGoldberg SDHack MDHawryluk NAJones WMKeith JMKrawczuk PLebsack ADLee-Dutra ALiu JMcClure KJMeduna SPPippel DJRosen MDSales ZS Flap modulators US Patent  US9745328 Publication Date 8/29/2017
More Info.:Get all data from this article,  Assay Method
 
Flap endonuclease 1
Name:Flap endonuclease 1
Synonyms:DNase IV | FEN-1 | FEN1 | Flap structure-specific endonuclease 1 | MF1 | Maturation factor 1 | RAD2 | hFEN-1
Type:PROTEIN
Mol. Mass.:42602.57
Organism:Homo sapiens (Human)
Description:ChEMBL_1517026
Residue:380
Sequence:
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGET
TSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAE
QEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDM
DCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRG
IGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSE
PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEP
KGSTKKKAKTGAAGKFKRGK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM337603
n/a
NameBDBM337603
Synonyms:4-{[4'-(5-Aminopyrazin-2-yl)-3'- fluorobiphenyl-2-yl]oxy}benzoic acid | US9745328, Compound 888
TypeSmall organic molecule
Emp. Form.C23H16FN3O3
Mol. Mass.401.3898
SMILESNc1cnc(cn1)-c1ccc(cc1F)-c1ccccc1Oc1ccc(cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: