| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
|---|
| Ligand | BDBM13924 |
|---|
| Substrate/Competitor | HIV Protease substrate |
|---|
| Meas. Tech. | Protease Inhibition Assay |
|---|
| pH | 6.4±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| Ki | 0.14±0.02 nM |
|---|
| Citation |  Ghosh, AK; Sridhar, PR; Leshchenko, S; Hussain, AK; Li, J; Kovalevsky, AY; Walters, DE; Wedekind, JE; Grum-Tokars, V; Das, D; Koh, Y; Maeda, K; Gatanaga, H; Weber, IT; Mitsuya, H Structure-Based Design of Novel HIV-1 Protease Inhibitors To Combat Drug Resistance. J Med Chem49:5252-61 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
|---|
| Name: | Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
|---|
| Synonyms: | HIV-1 Protease |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
|---|
| Synonyms: | HIV-1 Protease chain A | POL_HV1BR | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10732.11 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | The HIV-1 protease (Genbank HIVHXB2CG) clone was constructed with the substitutions Q7K, L33I, and L63I, to minimize the autoproteolysis of the protease, and C67A and C95A, to prevent cysteine-thiol oxidation. |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
|
|---|
| Component 2 |
| Name: | Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
|---|
| Synonyms: | HIV-1 Protease chain A | POL_HV1BR | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10732.11 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | The HIV-1 protease (Genbank HIVHXB2CG) clone was constructed with the substitutions Q7K, L33I, and L63I, to minimize the autoproteolysis of the protease, and C67A and C95A, to prevent cysteine-thiol oxidation. |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
|
|---|
| BDBM13924 |
|---|
| HIV Protease substrate |
|---|
| Name: | HIV Protease substrate |
|---|
| Synonyms: | Fluorogenic Peptide Substrate |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 3467.28 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 30 |
|---|
| Sequence: | 2-(aminobenzoyl)-Thr-Ile-Nle-Phe(p-NO2)-Gln-ArgNH2
|
|
|
|---|
Search and Browse
