Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease
LigandBDBM518
Substrate/CompetitorHIV Protease Chromogenic Peptide Substrate
Meas. Tech.Protease Inhibition Assay
pH4.7±n/a
Temperature310.15±n/a K
Ki 1.2±0.2 nM
Km18000±2000 nM
Commentskcat/Km=1.2 +/- 0.2 uM-1sec-1
Citation Clemente JCMoose REHemrajani RWhitford LRGovindasamy LReutzel RMcKenna RAgbandje-McKenna MGoodenow MMDunn BM Comparing the accumulation of active- and nonactive-site mutations in the HIV-1 protease. Biochemistry 43:12141-51 (2004) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Protease
Name:HIV-1 Protease
Synonyms:HIV-1 protease LAI variant
Type:Protein Complex
Mol. Mass.:n/a
Description:The HIV-1 PR DNA for HIV LAI variant was cloned, and protein was expressed, purified, and refolded from Escherichia coli strain BL21.
Components:This complex has 2 components.
Component 1
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM518
HIV Protease Chromogenic Peptide Substrate
Name:HIV Protease Chromogenic Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:1420.11
Organism:n/a
Description:n/a
Residue:13
Sequence:
K-A-R-V-L*Nph-E-A-nL-G