Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease Mutant V6(46/84)
LigandBDBM520
Substrate/CompetitorHIV Protease Chromogenic Peptide Substrate
Meas. Tech.Protease Inhibition Assay
Ki 345±n/a nM
Citation Clemente JCMoose REHemrajani RWhitford LRGovindasamy LReutzel RMcKenna RAgbandje-McKenna MGoodenow MMDunn BM Comparing the accumulation of active- and nonactive-site mutations in the HIV-1 protease. Biochemistry 43:12141-51 (2004) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Protease Mutant V6(46/84)
Name:HIV-1 Protease Mutant V6(46/84)
Synonyms:HIV-1 protease mutant (K20R V32I L33F M36I M46I L63P A71V V82A I84V L90M)
Type:Protein Complex
Mol. Mass.:n/a
Description:The post-ritonavir therapy protease variant plus M46I/I84V mutations, which were created by site-directed mutagenesis.
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease Mutant V6(46/84) chain A
Synonyms:HIV-1 Protease Mutant V6(46/84) chain B
Type:Enzyme Subunit
Mol. Mass.:10809.11
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLREALLDTGADDTIFEEISLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease Mutant V6(46/84) chain A
Synonyms:HIV-1 Protease Mutant V6(46/84) chain B
Type:Enzyme Subunit
Mol. Mass.:10809.11
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLREALLDTGADDTIFEEISLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM520
HIV Protease Chromogenic Peptide Substrate
Name:HIV Protease Chromogenic Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:1420.11
Organism:n/a
Description:n/a
Residue:13
Sequence:
K-A-R-V-L*Nph-E-A-nL-G