Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587,K509R,V521I,L522F,M525I,M535I,L552P,A560V,V571A,I573V,L579M] |
---|
Ligand | BDBM518 |
---|
Substrate/Competitor | HIV Protease Chromogenic Peptide Substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
Ki | 52±n/a nM |
---|
Citation | Clemente, JC; Moose, RE; Hemrajani, R; Whitford, LR; Govindasamy, L; Reutzel, R; McKenna, R; Agbandje-McKenna, M; Goodenow, MM; Dunn, BM Comparing the accumulation of active- and nonactive-site mutations in the HIV-1 protease. Biochemistry43:12141-51 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587,K509R,V521I,L522F,M525I,M535I,L552P,A560V,V571A,I573V,L579M] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587,K509R,V521I,L522F,M525I,M535I,L552P,A560V,V571A,I573V,L579M] |
Synonyms: | HIV-1 Protease Mutant V6(46/84) | HIV-1 protease mutant (K20R V32I L33F M36I M46I L63P A71V V82A I84V L90M) |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | The post-ritonavir therapy protease variant plus M46I/I84V mutations, which were created by site-directed mutagenesis. |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587,K509R,V521I,L522F,M525I,M535I,L552P,A560V,V571A,I573V,L579M] |
Synonyms: | HIV-1 Protease Mutant V6(46/84) chain A | HIV-1 Protease Mutant V6(46/84) chain B | POL_HV1H2 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10809.11 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587,K509R,V521I,L522F,M525I,M535I,L552P,A560V,V571A,I573V,L579M] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLREALLDTGADDTIFEEISLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587,K509R,V521I,L522F,M525I,M535I,L552P,A560V,V571A,I573V,L579M] |
Synonyms: | HIV-1 Protease Mutant V6(46/84) chain A | HIV-1 Protease Mutant V6(46/84) chain B | POL_HV1H2 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10809.11 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587,K509R,V521I,L522F,M525I,M535I,L552P,A560V,V571A,I573V,L579M] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLREALLDTGADDTIFEEISLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF
|
|
|
BDBM518 |
---|
HIV Protease Chromogenic Peptide Substrate |
---|
Name: | HIV Protease Chromogenic Peptide Substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 1420.11 |
Organism: | n/a |
Description: | n/a |
Residue: | 13 |
Sequence: | |