Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [482-580,I502K,I528M,T553A] |
---|
Ligand | BDBM520 |
---|
Substrate/Competitor | HIV Protease Chromogenic Peptide Substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 4.7±n/a |
---|
Temperature | 310.15±n/a K |
---|
Ki | 0.2±0.1 nM |
---|
Km | 15000±2000 nM |
---|
Comments | kcat/Km=0.54 +/- 0.07 uM-1sec-1 |
---|
Citation | Clemente, JC; Coman, RM; Thiaville, MM; Janka, LK; Jeung, JA; Nukoolkarn, S; Govindasamy, L; Agbandje-McKenna, M; McKenna, R; Leelamanit, W; Goodenow, MM; Dunn, BM Analysis of HIV-1 CRF_01 A/E protease inhibitor resistance: structural determinants for maintaining sensitivity and developing resistance to atazanavir. Biochemistry45:5468-77 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [482-580,I502K,I528M,T553A] |
---|
Name: | Dimer of Gag-Pol polyprotein [482-580,I502K,I528M,T553A] |
Synonyms: | HIV-1 CRF_01 A/E Protease | HIV-1 Protease AE | Pretherapy isolated AE protease containing the natural V3I, I13V, E35D, M36I, S37N, R41K, H69K, and L89M polymorphisms |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | HIV-1 protease DNA for all the HIV B and AE variants was cloned, and protein was expressed and purified from Escherichia coli strain BL21. |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [482-580,I502K,I528M,T553A] |
Synonyms: | HIV-1 Protease AE Chain A | HIV-1 Protease AE Chain B | POL_HV1U4 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10757.68 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P24740[482-580,I502K,I528M,T553A] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [482-580,I502K,I528M,T553A] |
Synonyms: | HIV-1 Protease AE Chain A | HIV-1 Protease AE Chain B | POL_HV1U4 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10757.68 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P24740[482-580,I502K,I528M,T553A] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
|
|
|
BDBM520 |
---|
HIV Protease Chromogenic Peptide Substrate |
---|
Name: | HIV Protease Chromogenic Peptide Substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 1420.11 |
Organism: | n/a |
Description: | n/a |
Residue: | 13 |
Sequence: | |