| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dimer of Gag-Pol polyprotein [482-580,I502K,I528M,T553A] |
|---|
| Ligand | BDBM519 |
|---|
| Substrate/Competitor | HIV Protease Chromogenic Peptide Substrate |
|---|
| Meas. Tech. | Protease Inhibition Assay |
|---|
| pH | 4.7±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| Ki | 1.8±0.3 nM |
|---|
| Km | 15000±2000 nM |
|---|
| Comments | kcat/Km=0.54 +/- 0.07 uM-1sec-1 |
|---|
| Citation |  Clemente, JC; Coman, RM; Thiaville, MM; Janka, LK; Jeung, JA; Nukoolkarn, S; Govindasamy, L; Agbandje-McKenna, M; McKenna, R; Leelamanit, W; Goodenow, MM; Dunn, BM Analysis of HIV-1 CRF_01 A/E protease inhibitor resistance: structural determinants for maintaining sensitivity and developing resistance to atazanavir. Biochemistry45:5468-77 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dimer of Gag-Pol polyprotein [482-580,I502K,I528M,T553A] |
|---|
| Name: | Dimer of Gag-Pol polyprotein [482-580,I502K,I528M,T553A] |
|---|
| Synonyms: | HIV-1 CRF_01 A/E Protease | HIV-1 Protease AE | Pretherapy isolated AE protease containing the natural V3I, I13V, E35D, M36I, S37N, R41K, H69K, and L89M polymorphisms |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | HIV-1 protease DNA for all the HIV B and AE variants was cloned, and protein was expressed and purified from Escherichia coli strain BL21. |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Gag-Pol polyprotein [482-580,I502K,I528M,T553A] |
|---|
| Synonyms: | HIV-1 Protease AE Chain A | HIV-1 Protease AE Chain B | POL_HV1U4 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10757.68 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P24740[482-580,I502K,I528M,T553A] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
|
|
|
|---|
| Component 2 |
| Name: | Gag-Pol polyprotein [482-580,I502K,I528M,T553A] |
|---|
| Synonyms: | HIV-1 Protease AE Chain A | HIV-1 Protease AE Chain B | POL_HV1U4 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10757.68 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P24740[482-580,I502K,I528M,T553A] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
|
|
|
|---|
| BDBM519 |
|---|
| HIV Protease Chromogenic Peptide Substrate |
|---|
| Name: | HIV Protease Chromogenic Peptide Substrate |
|---|
| Synonyms: | n/a |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 1420.11 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 13 |
|---|
| Sequence: | |
|---|
Search and Browse
