Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease AE-P Mutant (F82V)
LigandBDBM520
Substrate/CompetitorHIV Protease Chromogenic Peptide Substrate
Meas. Tech.Protease Inhibition Assay
Ki 1.2±n/a nM
Citation Clemente JCComan RMThiaville MMJanka LKJeung JANukoolkarn SGovindasamy LAgbandje-McKenna MMcKenna RLeelamanit WGoodenow MMDunn BM Analysis of HIV-1 CRF_01 A/E protease inhibitor resistance: structural determinants for maintaining sensitivity and developing resistance to atazanavir. Biochemistry 45:5468-77 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Protease AE-P Mutant (F82V)
Name:HIV-1 Protease AE-P Mutant (F82V)
Synonyms:HIV-1 Protease AE-P Mutant (F82V) (V3I, L10I, I13V, L33I, E35D, M36I, S37N, R41K, I54V, L63H, H69K, L89M) | Post-therapy HIV-1 CRF_01 A/E protease F82V back mutant
Type:Protein Complex
Mol. Mass.:n/a
Description:HIV-1 protease DNA for all the HIV B and AE variants was cloned, and protein was expressed and purified from Escherichia coli strain BL21.
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease AE-P Mutant (F82V) Chain A
Synonyms:HIV-1 Protease AE-P Mutant (F82V) Chain B
Type:Enzyme Subunit
Mol. Mass.:10768.14
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVIEDINLPGKWKPKMIGGIGGFVKVRQYD
QIHIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease AE-P Mutant (F82V) Chain A
Synonyms:HIV-1 Protease AE-P Mutant (F82V) Chain B
Type:Enzyme Subunit
Mol. Mass.:10768.14
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVIEDINLPGKWKPKMIGGIGGFVKVRQYD
QIHIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM520
HIV Protease Chromogenic Peptide Substrate
Name:HIV Protease Chromogenic Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:1420.11
Organism:n/a
Description:n/a
Residue:13
Sequence:
K-A-R-V-L*Nph-E-A-nL-G