Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [490-588,L523I,E525D,M526I,I544V,L553H,H559K,L579M] |
---|
Ligand | BDBM13934 |
---|
Substrate/Competitor | HIV Protease Chromogenic Peptide Substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
Ki | 1.1±n/a nM |
---|
Citation | Clemente, JC; Coman, RM; Thiaville, MM; Janka, LK; Jeung, JA; Nukoolkarn, S; Govindasamy, L; Agbandje-McKenna, M; McKenna, R; Leelamanit, W; Goodenow, MM; Dunn, BM Analysis of HIV-1 CRF_01 A/E protease inhibitor resistance: structural determinants for maintaining sensitivity and developing resistance to atazanavir. Biochemistry45:5468-77 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [490-588,L523I,E525D,M526I,I544V,L553H,H559K,L579M] |
---|
Name: | Dimer of Gag-Pol polyprotein [490-588,L523I,E525D,M526I,I544V,L553H,H559K,L579M] |
Synonyms: | HIV-1 Protease AE-P Mutant (F82V) | HIV-1 Protease AE-P Mutant (F82V) (V3I, L10I, I13V, L33I, E35D, M36I, S37N, R41K, I54V, L63H, H69K, L89M) | Post-therapy HIV-1 CRF_01 A/E protease F82V back mutant |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | HIV-1 protease DNA for all the HIV B and AE variants was cloned, and protein was expressed and purified from Escherichia coli strain BL21.
|
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [490-588,L523I,E525D,M526I,I544V,L553H,H559K,L579M] |
Synonyms: | HIV-1 Protease AE-P Mutant (F82V) Chain A | HIV-1 Protease AE-P Mutant (F82V) Chain B | POL_HV1RH | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10768.14 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P05959[490-588,L523I,E525D,M526I,I544V,L553H,H559K,L579M] |
Residue: | 99 |
Sequence: | PQITLWQRPIVTVKIGGQLKEALLDTGADDTVIEDINLPGKWKPKMIGGIGGFVKVRQYD
QIHIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [490-588,L523I,E525D,M526I,I544V,L553H,H559K,L579M] |
Synonyms: | HIV-1 Protease AE-P Mutant (F82V) Chain A | HIV-1 Protease AE-P Mutant (F82V) Chain B | POL_HV1RH | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10768.14 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P05959[490-588,L523I,E525D,M526I,I544V,L553H,H559K,L579M] |
Residue: | 99 |
Sequence: | PQITLWQRPIVTVKIGGQLKEALLDTGADDTVIEDINLPGKWKPKMIGGIGGFVKVRQYD
QIHIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
|
|
|
BDBM13934 |
---|
HIV Protease Chromogenic Peptide Substrate |
---|
Name: | HIV Protease Chromogenic Peptide Substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 1420.11 |
Organism: | n/a |
Description: | n/a |
Residue: | 13 |
Sequence: | |