| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
|---|
| Ligand | BDBM13936 |
|---|
| Substrate/Competitor | Chromogenic Substrate |
|---|
| Meas. Tech. | Protease Inhibition Assay |
|---|
| pH | 5±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Ki | 2170±n/a nM |
|---|
| Km | 55000±7000 nM |
|---|
| Comments | kcat/Km=5.2 +/- 0.2 min-1uM-1 |
|---|
| Citation |  Liu, F; Boross, PI; Wang, YF; Tozser, J; Louis, JM; Harrison, RW; Weber, IT Kinetic, stability, and structural changes in high-resolution crystal structures of HIV-1 protease with drug-resistant mutations L24I, I50V, and G73S. J Mol Biol354:789-800 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
|---|
| Name: | Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
|---|
| Synonyms: | HIV-1 Protease |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | The HIV-1 PR (Genbank HIVHXB2CG) clone was constructed with the substitutions Q7K, L33I, and L63I to minimize the autoproteolysis of the PR, and C67A and C95A to prevent cysteine-thiol oxidation. |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
|---|
| Synonyms: | HIV-1 Protease chain A | POL_HV1BR | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10732.11 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | The HIV-1 protease (Genbank HIVHXB2CG) clone was constructed with the substitutions Q7K, L33I, and L63I, to minimize the autoproteolysis of the protease, and C67A and C95A, to prevent cysteine-thiol oxidation. |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
|
|---|
| Component 2 |
| Name: | Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
|---|
| Synonyms: | HIV-1 Protease chain A | POL_HV1BR | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10732.11 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | The HIV-1 protease (Genbank HIVHXB2CG) clone was constructed with the substitutions Q7K, L33I, and L63I, to minimize the autoproteolysis of the protease, and C67A and C95A, to prevent cysteine-thiol oxidation. |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
|
|---|
| BDBM13936 |
|---|
| Chromogenic Substrate |
|---|
| Name: | Chromogenic Substrate |
|---|
| Synonyms: | CA/p2# |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 2887.67 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 25 |
|---|
| Sequence: | K-A-R-V-Nle-(p-nitroPhe)-E-A-Nle-amide
|
|
|
|---|
Search and Browse
