Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease Mutant (L24I)
LigandBDBM517
Substrate/CompetitorChromogenic Substrate
Meas. Tech.Protease Inhibition Assay
pH5±n/a
Temperature295.15±n/a K
Ki 1.4±n/a nM
Km310000±45000 nM
Commentskcat/Km=0.19 +/- 0.03 min-1uM-1
Citation Liu FBoross PIWang YFTozser JLouis JMHarrison RWWeber IT Kinetic, stability, and structural changes in high-resolution crystal structures of HIV-1 protease with drug-resistant mutations L24I, I50V, and G73S. J Mol Biol 354:789-800 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Protease Mutant (L24I)
Name:HIV-1 Protease Mutant (L24I)
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:The HIV-1 PR DNA for all of wildtype and mutants was cloned, and protein was expressed, purified, and refolded from Escherichia coli strain BL21.
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease Mutant (L24I) chain A
Synonyms:HIV-1 Protease Mutant (L24I) chain B
Type:Enzyme Subunit
Mol. Mass.:10732.11
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWKRPLVTIKIGGQLKEALIDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease Mutant (L24I) chain A
Synonyms:HIV-1 Protease Mutant (L24I) chain B
Type:Enzyme Subunit
Mol. Mass.:10732.11
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWKRPLVTIKIGGQLKEALIDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM517
Chromogenic Substrate
Name:Chromogenic Substrate
Synonyms:CA/p2#
Type:Peptide
Mol. Mass.:2887.67
Organism:n/a
Description:n/a
Residue:25
Sequence:
K-A-R-V-Nle-(p-nitroPhe)-E-A-Nle-amide