Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease Mutant (I50V)
LigandBDBM517
Substrate/CompetitorChromogenic Substrate
Meas. Tech.Protease Inhibition Assay
pH5±n/a
Temperature295.15±n/a K
Ki 27±n/a nM
Km500000±36000 nM
Commentskcat/Km=0.93 +/- 0.08 min-1uM-1
Citation Liu FBoross PIWang YFTozser JLouis JMHarrison RWWeber IT Kinetic, stability, and structural changes in high-resolution crystal structures of HIV-1 protease with drug-resistant mutations L24I, I50V, and G73S. J Mol Biol 354:789-800 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Protease Mutant (I50V)
Name:HIV-1 Protease Mutant (I50V)
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:The HIV-1 PR DNA for all of wildtype and mutants was cloned, and protein was expressed, purified, and refolded from Escherichia coli strain BL21.
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease Mutant (I50V) chain A
Synonyms:HIV-1 Protease Mutant (I50V) chain B
Type:Enzyme Subunit
Mol. Mass.:10718.08
Organism:Human immunodeficiency virus type 1
Description:All of the mutant constructs in this study are on the wild type containing the substitutions Q7K, L33I, and L63I, to minimize the autoproteolysis of the protease, and C67A and C95A, to prevent cysteine-thiol oxidation.
Residue:99
Sequence:
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGVGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease Mutant (I50V) chain A
Synonyms:HIV-1 Protease Mutant (I50V) chain B
Type:Enzyme Subunit
Mol. Mass.:10718.08
Organism:Human immunodeficiency virus type 1
Description:All of the mutant constructs in this study are on the wild type containing the substitutions Q7K, L33I, and L63I, to minimize the autoproteolysis of the protease, and C67A and C95A, to prevent cysteine-thiol oxidation.
Residue:99
Sequence:
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGVGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM517
Chromogenic Substrate
Name:Chromogenic Substrate
Synonyms:CA/p2#
Type:Peptide
Mol. Mass.:2887.67
Organism:n/a
Description:n/a
Residue:25
Sequence:
K-A-R-V-Nle-(p-nitroPhe)-E-A-Nle-amide