Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast growth factor receptor 3
LigandBDBM339807
Substrate/Competitorn/a
Meas. Tech.FGFR3 (Enzymatic Assay)
IC50 0.501±n/a nM
Citation Angibaud PRObringer MMarin JJJeanty M Naphthyridine derivative compounds US Patent  US9757364 Publication Date 9/12/2017
More Info.:Get all data from this article,  Assay Method
 
Fibroblast growth factor receptor 3
Name:Fibroblast growth factor receptor
Synonyms:CD_antigen: CD333 | FGFR-3 | FGFR3 | Fibroblast growth factor receptor 3 (FGFR3) | JTK4
Type:Protein
Mol. Mass.:87699.57
Organism:Homo sapiens (Human)
Description:P22607
Residue:806
Sequence:
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCH
FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAE
EELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK
RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGE
GCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIIN
LLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ
VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW
MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCT
HDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSS
SSSGDDSVFAHDLLPPAPPSSGGSRT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM339807
n/a
NameBDBM339807
Synonyms:US9757364, Compound 11
TypeSmall organic molecule
Emp. Form.C23H24ClN5O3
Mol. Mass.453.921
SMILESCOc1cc(OC)cc(c1)N(CCCO)c1ccc2ncc(-c3cnn(C)c3)c(Cl)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: