Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosomal protein S6 kinase alpha 2
LigandBDBM286088
Substrate/Competitorn/a
Meas. Tech.Kinase Assay
IC50 1377000±n/a nM
Citation Dunn SEJayanthan ANagireddy JRAnnedi SVan Drie JHDaynard TSHuynh M Substituted tetrahydropyrido[3′,2′:4,5]pyrrolo[1,2-a]pyrazine-2-carboxamides as RSK inhibitors US Patent  US9771366 Publication Date 9/26/2017
More Info.:Get all data from this article,  Assay Method
 
Ribosomal protein S6 kinase alpha 2
Name:Ribosomal protein S6 kinase alpha 2
Synonyms:90 kDa ribosomal protein S6 kinase 2 | 90 kDa ribosomal protein S6 kinase 2 (RSK2) | MAP kinase-activated protein kinase 1c | MAPKAPK1C | RPS6KA2(Kin.Dom.1 - N-terminal) | Ribosomal S6 Kinase 3 (RSK-3) | Ribosomal protein S6 kinase alpha-2 | p90-RSK 2 | pp90RSK3
Type:Serine/threonine-protein kinase
Mol. Mass.:83259.46
Organism:Homo sapiens (Human)
Description:n/a
Residue:733
Sequence:
MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEGFEKADPSQFE
LLKVLGQGSYGKVFLVRKVKGSDAGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPF
IVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGI
IYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSA
DWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQFLSGEAQSLLRALFKRNPCN
RLGAGIDGVEEIKRHPFFVTIDWNTLYRKEIKPPFKPAVGRPEDTFHFDPEFTARTPTDS
PGVPPSANAHHLFRGFSFVASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIKED
IGVGSYSVCKRCVHKATDTEYAVKIIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGK
FVYLVMELMRGGELLDRILRQRYFSEREASDVLCTITKTMDYLHSQGVVHRDLKPSNILY
RDESGSPESIRVCDFGFAKQLRAGNGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGIL
LYTMLAGFTPFANGPDDTPEEILARIGSGKYALSGGNWDSISDAAKDVVSKMLHVDPHQR
LTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLA
QRRGMKRLTSTRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM286088
n/a
NameBDBM286088
Synonyms:(R)-1-benzyl-N-(9-methyl-6-oxo-6,7,8,9-tetrahydropyrido[3′,2′:4,5]pyrrolo[1,2-a]pyrazin-2-yl)-1H-pyrazole-4-carboxamide | US10081632, Compound 15 | US9771366, Compound 11
TypeSmall organic molecule
Emp. Form.C23H21N5O2
Mol. Mass.399.4451
SMILESC[C@@H]1CNC(=O)c2cc3ccc(NC(=O)c4cnn(Cc5ccccc5)c4)cc3n12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: