Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4B
LigandBDBM14380
Substrate/CompetitorBDBM10851
Meas. Tech.PDE Activity Assay
Ki 26.6±n/a nM
Citation Whitehead JWLee GPGharagozloo PHofer PGehrig AWintergerst PSmyth DMcCoull WHachicha MPatel AKyle DJ 8-Substituted analogues of 3-(3-cyclopentyloxy-4-methoxy-benzyl)-8-isopropyladenine: highly potent and selective PDE4 inhibitors. J Med Chem 48:1237-43 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4B
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 4B
Synonyms:DPDE4 | Isoform PDE4B1 | PDE32 | PDE4B1 | Phosphodiesterase 4B | Phosphodiesterase 4B (PDE4B) | Phosphodiesterase 4B (PDE4B1) | Phosphodiesterase Type 4 (PDE4B)
Type:Protein
Mol. Mass.:83318.87
Organism:Homo sapiens (Human)
Description:Q07343-1
Residue:736
Sequence:
MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQS
ERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVL
HATFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVR
NNFTILTNLHGTSNKRSPAASQPPVSRVNPQEESYQKLAMETLEELDWCLDQLETIQTYR
SVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKK
KQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSH
NRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL
AVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTS
SGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEI
SPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSP
SPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLG
ETDIDIATEDKSPVDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14380
BDBM10851
NameBDBM14380
Synonyms:3-(3-Cyclopentyloxy-4-methoxy-benzyl)-8-[1-(4-trifluoromethoxy-benzyloxy)-1-methyl-ethyl]-3Hpurin-6-ylamine | 3-{[3-(cyclopentyloxy)-4-methoxyphenyl]methyl}-8-(2-{[4-(trifluoromethoxy)phenyl]methoxy}propan-2-yl)-3H-purin-6-amine | V11294 Analogue 5p
TypeSmall organic molecule
Emp. Form.C29H32F3N5O4
Mol. Mass.571.5907
SMILESCOc1ccc(Cn2cnc(N)c3nc(nc23)C(C)(C)OCc2ccc(OC(F)(F)F)cc2)cc1OC1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: