Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4D
LigandBDBM14366
Substrate/CompetitorBDBM10851
Meas. Tech.PDE Activity Assay
Ki 5.1±n/a nM
Citation Whitehead JWLee GPGharagozloo PHofer PGehrig AWintergerst PSmyth DMcCoull WHachicha MPatel AKyle DJ 8-Substituted analogues of 3-(3-cyclopentyloxy-4-methoxy-benzyl)-8-isopropyladenine: highly potent and selective PDE4 inhibitors. J Med Chem 48:1237-43 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Synonyms:DPDE3 | PDE43 | PDE4D | Phosphodiesterase 4D
Type:Protein
Mol. Mass.:91092.69
Organism:Homo sapiens (Human)
Description:Q08499
Residue:809
Sequence:
MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPP
PPPSPQPQPQCPLQPPPPPPLPPPPPPPGAARGRYASSGATGRVRHRGYSDTERYLYCRA
MDRTSYAVETGHRPGLKKSRMSWPSSFQGLRRFDVDNGTSAGRSPLDPMTSPGSGLILQA
NFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNF
AALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSV
SEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPTQKEKEKKKRP
MSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPL
TVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLST
PALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGF
KLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVL
LLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMC
DKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAP
DDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPL
DEQVEEEAVGEEEESQPEACVIDDRSPDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14366
BDBM10851
NameBDBM14366
Synonyms:3-(3-Cyclopentyloxy-4-methoxy-benzyl)-8-[1-(2-methoxy-benzyloxy)-1-methyl-ethyl]-3H-purine-6-ylamine | 3-{[3-(cyclopentyloxy)-4-methoxyphenyl]methyl}-8-{2-[(2-methoxyphenyl)methoxy]propan-2-yl}-3H-purin-6-amine | V11294 Analogue 5b
TypeSmall organic molecule
Emp. Form.C29H35N5O4
Mol. Mass.517.6193
SMILESCOc1ccccc1COC(C)(C)c1nc2c(N)ncn(Cc3ccc(OC)c(OC4CCCC4)c3)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: