Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast growth factor receptor 2
LigandBDBM340013
Substrate/Competitorn/a
Meas. Tech.Inhibition Kinases In Vitro Assay
IC50 2.19±n/a nM
Citation Zdzalik DLipner JWieczorek MDzwonek KYamani ADubiel KLamparska-Przybysz MGrygielewicz PStanczak A Pyrazolylbenzo[d]imidazole derivatives US Patent  US9776988 Publication Date 10/3/2017
More Info.:Get all data from this article,  Assay Method
 
Fibroblast growth factor receptor 2
Name:Fibroblast growth factor receptor 2
Synonyms:BEK | CD_antigen=CD332 | FGFR-2 | FGFR-2 Tyrosine Kinase | FGFR2 | Fibroblast growth factor receptor 2 (FGFR2) | Fibroblast growth factor receptor 2 precursor | KGFR | KSAM | Keratinocyte growth factor receptor | Keratinocyte growth factor receptor 2
Type:Enzyme
Mol. Mass.:92015.45
Organism:Homo sapiens (Human)
Description:P21802
Residue:821
Sequence:
MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEV
RCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYF
MVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP
AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSI
NHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSK
YGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL
PAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTK
RIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDK
LTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKM
IGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTF
KDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKT
TNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGH
RMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYS
PSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM340013
n/a
NameBDBM340013
Synonyms:US9776988, Example 2
TypeSmall organic molecule
Emp. Form.C25H27N5O4
Mol. Mass.461.513
SMILESCOc1cc(CCc2cc(n[nH]2)-c2nc3cc(ccc3[nH]2)C(=O)N2CCOCC2)cc(OC)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: