| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM14482 |
|---|
| Substrate/Competitor | BDBM12679 |
|---|
| Meas. Tech. | Enzyme Assay and Determination of the Inhibition Constants |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Ki | 37000±n/a nM |
|---|
| Citation |  Katz, BA; Luong, C; Ho, JD; Somoza, JR; Gjerstad, E; Tang, J; Williams, SR; Verner, E; Mackman, RL; Young, WB; Sprengeler, PA; Chan, H; Mortara, K; Janc, JW; McGrath, ME Dissecting and designing inhibitor selectivity determinants at the S1 site using an artificial Ala190 protease (Ala190 uPA). J Mol Biol344:527-47 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26557.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P07477 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
|---|
| BDBM14482 |
|---|
| BDBM12679 |
|---|
| Name | BDBM14482 |
|---|
| Synonyms: | 2-amino-5-[(3-hydroxynaphthalene-2-)amido]-1H-1,3-benzodiazol-3-ium | CA-24 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H15N4O2 |
|---|
| Mol. Mass. | 319.3368 |
|---|
| SMILES | Nc1[nH]c2ccc(NC(=O)c3cc4ccccc4cc3O)cc2[nH+]1 |
|---|
| Structure | 
|
|---|
Search and Browse
