Reaction Details |
| Report a problem with these data |
Target | Urokinase-type plasminogen activator [179-431,I214M,N322A,S371A] |
---|
Ligand | BDBM14480 |
---|
Substrate/Competitor | BDBM14484 |
---|
Meas. Tech. | Enzyme Assay and Determination of the Inhibition Constants |
---|
Ki | 10000±n/a nM |
---|
Citation | Katz, BA; Luong, C; Ho, JD; Somoza, JR; Gjerstad, E; Tang, J; Williams, SR; Verner, E; Mackman, RL; Young, WB; Sprengeler, PA; Chan, H; Mortara, K; Janc, JW; McGrath, ME Dissecting and designing inhibitor selectivity determinants at the S1 site using an artificial Ala190 protease (Ala190 uPA). J Mol Biol344:527-47 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Urokinase-type plasminogen activator [179-431,I214M,N322A,S371A] |
---|
Name: | Urokinase-type plasminogen activator [179-431,I214M,N322A,S371A] |
Synonyms: | LMW uPA | PLAU | U-plasminogen activator | UROK_HUMAN | Urokinase (uPA) Mutant (S190A) | deglycosylated (N145A) LMW uPA Mutant S190A |
Type: | Enzyme |
Mol. Mass.: | 28389.65 |
Organism: | Homo sapiens (Human) |
Description: | Mutagenically deglycosylated (N145A) low molecular mass urokinase (S190A), referred to as Ala190 uPA. |
Residue: | 253 |
Sequence: | IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVY
LGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTI
CLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTK
MLCAADPQWKTDACQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPW
IRSHTKEENGLAL
|
|
|
BDBM14480 |
---|
BDBM14484 |
---|
Name | BDBM14480 |
Synonyms: | CA-22 | [amino({4-[(3-hydroxynaphthalene-2-)amido]phenyl}amino)methylidene]azanium |
Type | Small organic molecule |
Emp. Form. | C18H17N4O2 |
Mol. Mass. | 321.3526 |
SMILES | [#7]\[#6](-[#7])=[#7+]/c1ccc(-[#7]-[#6](=O)-c2cc3ccccc3cc2-[#8])cc1 |
Structure |
|