| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Retinol-binding protein 4 |
|---|
| Ligand | BDBM249469 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Scintillation Proximity Binding Assay |
|---|
| IC50 | <1.37±n/a nM |
|---|
| Citation |  Petrukhin, K; Cioffi, C; Johnson, G; Allikmets, R; Freeman, E; Chen, P; Conlon, M; Zhu, L Substituted 4-phenylpiperidines, their preparation and use US Patent US9777010 Publication Date 10/3/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Retinol-binding protein 4 |
|---|
| Name: | Retinol-binding protein 4 |
|---|
| Synonyms: | PRBP | Plasma retinol-binding protein | RBP | RBP4 | RET4_HUMAN | Retinol-binding protein 4 | Retinol-binding protein 4 (RBP4) | spa binding assay for rbp4 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23008.75 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P02753 |
|---|
| Residue: | 201 |
|---|
| Sequence: | MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
|
|
|
|---|
| BDBM249469 |
|---|
| n/a |
|---|
| Name | BDBM249469 |
|---|
| Synonyms: | US10072016, Compound 68 | US10407433, Compound 68 | US10913746, Compound 68 | US11649240, Compound 68 | US9434727, 68 | US9777010, Compound 68 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H22F4N4O3 |
|---|
| Mol. Mass. | 454.418 |
|---|
| SMILES | COC(=O)N1CCc2[nH]nc(C(=O)N3CCC(CC3)c3cccc(F)c3C(F)(F)F)c2C1 |
|---|
| Structure | 
|
|---|
Search and Browse
