Reaction Details |
| Report a problem with these data |
Target | Vitamin K-dependent protein C |
---|
Ligand | BDBM14714 |
---|
Substrate/Competitor | BDBM13573 |
---|
Meas. Tech. | Serine Protease Inhibition Assay |
---|
pH | 7.8±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 87±3 nM |
---|
Citation | Olivero, AG; Eigenbrot, C; Goldsmith, R; Robarge, K; Artis, DR; Flygare, J; Rawson, T; Sutherlin, DP; Kadkhodayan, S; Beresini, M; Elliott, LO; DeGuzman, GG; Banner, DW; Ultsch, M; Marzec, U; Hanson, SR; Refino, C; Bunting, S; Kirchhofer, D A selective, slow binding inhibitor of factor VIIa binds to a nonstandard active site conformation and attenuates thrombus formation in vivo. J Biol Chem280:9160-9 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Vitamin K-dependent protein C |
---|
Name: | Vitamin K-dependent protein C |
Synonyms: | Activated protein C cofactor | Anticoagulant protein C | Apolipoprotein H | Autoprothrombin IIA | Blood coagulation factor XIV | Coagulation factor V | Coagulation factor V heavy chain | Coagulation factor V light chain | Endothelial protein C receptor | PROC | PROC_HUMAN | Proaccelerin, labile factor | Vitamin K-dependent protein C precursor |
Type: | Enzyme |
Mol. Mass.: | 52067.73 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 461 |
Sequence: | MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECI
EEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSC
DCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVK
FPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGA
VLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI
ALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVL
NFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV
SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP
|
|
|
BDBM14714 |
---|
BDBM13573 |
---|
Name | BDBM14714 |
Synonyms: | (2R)-N-[(3-aminobenzene)sulfonyl]-2-[(4-carbamimidoyl-3-hydroxyphenyl)amino]-2-(3,5-diethoxy-2-fluorophenyl)acetamide | G17905 | R-4-[2-(3-aminobenzenesulfonylamino)-1-(3,5-diethoxy-2-fluorophenyl)-2-oxoethylamino]-2-hydroxy-benzamidine.TFA |
Type | Small organic molecule |
Emp. Form. | C25H28FN5O6S |
Mol. Mass. | 545.583 |
SMILES | CCOc1cc(OCC)c(F)c(c1)[C@@H](Nc1ccc(C(N)=N)c(O)c1)C(=O)NS(=O)(=O)c1cccc(N)c1 |r| |
Structure |
|