| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM14714 |
|---|
| Substrate/Competitor | BDBM13574 |
|---|
| Meas. Tech. | Serine Protease Inhibition Assay |
|---|
| pH | 7.8±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Ki | 4000±n/a nM |
|---|
| Citation |  Olivero, AG; Eigenbrot, C; Goldsmith, R; Robarge, K; Artis, DR; Flygare, J; Rawson, T; Sutherlin, DP; Kadkhodayan, S; Beresini, M; Elliott, LO; DeGuzman, GG; Banner, DW; Ultsch, M; Marzec, U; Hanson, SR; Refino, C; Bunting, S; Kirchhofer, D A selective, slow binding inhibitor of factor VIIa binds to a nonstandard active site conformation and attenuates thrombus formation in vivo. J Biol Chem280:9160-9 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25790.52 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | P00760 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
|---|
| BDBM14714 |
|---|
| BDBM13574 |
|---|
| Name | BDBM14714 |
|---|
| Synonyms: | (2R)-N-[(3-aminobenzene)sulfonyl]-2-[(4-carbamimidoyl-3-hydroxyphenyl)amino]-2-(3,5-diethoxy-2-fluorophenyl)acetamide | G17905 | R-4-[2-(3-aminobenzenesulfonylamino)-1-(3,5-diethoxy-2-fluorophenyl)-2-oxoethylamino]-2-hydroxy-benzamidine.TFA |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H28FN5O6S |
|---|
| Mol. Mass. | 545.583 |
|---|
| SMILES | CCOc1cc(OCC)c(F)c(c1)[C@@H](Nc1ccc(C(N)=N)c(O)c1)C(=O)NS(=O)(=O)c1cccc(N)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
