Reaction Details |
| Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM349578 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Competitive Radioligand Binding Assay 2 |
---|
Ki | 1.40±n/a nM |
---|
Citation | Rishton, GM; Catalano, SM; Look, GC Isoindoline compositions and methods for treating neurodegenerative disease US Patent US10207991 Publication Date 2/19/2019 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | MAC30 | Meningioma-associated protein 30 | S2R | SGMR2_HUMAN | Sigma-2 receptor | Sigma2 receptor | TMEM97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20857.20 |
Organism: | Homo sapiens (Human) |
Description: | Q5BJF2 |
Residue: | 176 |
Sequence: | MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
|
|
|
BDBM349578 |
---|
n/a |
---|
Name | BDBM349578 |
Synonyms: | US10207991, Ex. Cpd. No. 103 | US10611728, Example Compound 103 | US11691947, Example 103 |
Type | Small organic molecule |
Emp. Form. | C21H27NO3S |
Mol. Mass. | 373.509 |
SMILES | COc1cccc(CCC(C)(C)N2Cc3ccc(cc3C2)S(C)(=O)=O)c1 |
Structure |
|