Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntermediate conductance calcium-activated potassium channel protein 4
LigandBDBM205069
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7.3±n/a
IC50 17.0±0 nM
Commentsextracted
Citation Demnitz JJorgensen S Tetrazole derivatives and their use as potassium channel modulators US Patent  US9556132 Publication Date 1/31/2017
More Info.:Get all data from this article,  Assay Method
 
Intermediate conductance calcium-activated potassium channel protein 4
Name:Intermediate conductance calcium-activated potassium channel protein 4
Synonyms:IK1 | IKCa1 | KCa4 | Putative Gardos channel | SK4
Type:PROTEIN
Mol. Mass.:47723.22
Organism:Homo sapiens (Human)
Description:ChEMBL_1361891
Residue:427
Sequence:
MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFL
VKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPA
PVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR
SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDT
LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
LREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP
EPSQQSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM205069
n/a
NameBDBM205069
Synonyms:US9556132, 33 | process for preparing 5-{2-[2-(fluoromethyl)phenyl]phenyl}-1-(2-fluorophenyl)-1h-1,2,3,4-tetrazole
TypeSmall organic molecule
Emp. Form.C20H14F2N4
Mol. Mass.348.3488
SMILESFCc1ccccc1-c1ccccc1-c1nnnn1-c1ccccc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: