| Reaction Details |
|---|
 | Report a problem with these data |
| Target | cAMP-specific 3',5'-cyclic phosphodiesterase 7B [91-450] |
|---|
| Ligand | BDBM14774 |
|---|
| Substrate/Competitor | BDBM10851 |
|---|
| Meas. Tech. | Phosphodiesterase (PDE) Inhibition Assay |
|---|
| IC50 | >200000±n/a nM |
|---|
| Citation |  Card, GL; England, BP; Suzuki, Y; Fong, D; Powell, B; Lee, B; Luu, C; Tabrizizad, M; Gillette, S; Ibrahim, PN; Artis, DR; Bollag, G; Milburn, MV; Kim, SH; Schlessinger, J; Zhang, KY Structural basis for the activity of drugs that inhibit phosphodiesterases. Structure12:2233-47 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| cAMP-specific 3',5'-cyclic phosphodiesterase 7B [91-450] |
|---|
| Name: | cAMP-specific 3',5'-cyclic phosphodiesterase 7B [91-450] |
|---|
| Synonyms: | PDE7B | PDE7B_HUMAN | Phosphodiesterase Type 7 (PDE7B) | cAMP-specific 3,5-cyclic phosphodiesterase 7B |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 41494.16 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Recombinant catalytic domain (Q91-P450) of human PDE7B. |
|---|
| Residue: | 360 |
|---|
| Sequence: | QAPLHLLDEDYLGQARHMLSKVGMWDFDIFLFDRLTNGNSLVTLLCHLFNTHGLIHHFKL
DMVTLHRFLVMVQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIMLGLLAA
AAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLRESRLLAHLPKEMTQD
IEQQLGSLILATDINRQNEFLTRLKAHLHNKDLRLEDAQDRHFMLQIALKCADICNPCRI
WEMSKQWSERVCEEFYRQGELEQKFELEISPLCNQQKDSIPSIQIGFMSYIVEPLFREWA
HFTGNSTLSENMLGHLAHNKAQWKSLLPRQHRSRGSSGSGPDHDHAGQGTESEEQEGDSP
|
|
|
|---|
| BDBM14774 |
|---|
| BDBM10851 |
|---|
| Name | BDBM14774 |
|---|
| Synonyms: | 3-(cyclopropylmethoxy)-N-(3,5-dichloropyridin-4-yl)-4-(difluoromethoxy)benzamide | CHEMBL193240 | DAXAS | ROF | Roflumilast |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H14Cl2F2N2O3 |
|---|
| Mol. Mass. | 403.207 |
|---|
| SMILES | FC(F)Oc1ccc(cc1OCC1CC1)C(=O)Nc1c(Cl)cncc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
