Reaction Details |
| Report a problem with these data |
Target | cAMP-dependent protein kinase catalytic subunit alpha |
---|
Ligand | BDBM15022 |
---|
Substrate/Competitor | biotinylated kemptide |
---|
Meas. Tech. | PKA/PKC Kinase Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 295.15±n/a K |
---|
IC50 | 38±n/a nM |
---|
Citation | Li, Q; Woods, KW; Thomas, S; Zhu, GD; Packard, G; Fisher, J; Li, T; Gong, J; Dinges, J; Song, X; Abrams, J; Luo, Y; Johnson, EF; Shi, Y; Liu, X; Klinghofer, V; Des Jong, R; Oltersdorf, T; Stoll, VS; Jakob, CG; Rosenberg, SH; Giranda, VL Synthesis and structure-activity relationship of 3,4'-bispyridinylethylenes: discovery of a potent 3-isoquinolinylpyridine inhibitor of protein kinase B (PKB/Akt) for the treatment of cancer. Bioorg Med Chem Lett16:2000-7 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
cAMP-dependent protein kinase catalytic subunit alpha |
---|
Name: | cAMP-dependent protein kinase catalytic subunit alpha |
Synonyms: | KAPCA_BOVIN | PKA C-alpha | PKC | PRKACA | Protein Kinase C | Protein Kinase C, bovine brain | cAMP-Dependent Protein Kinase (PKA) | cAMP-dependent Protein Kinase, bovine heart | cAMP-dependent protein kinase A | cAMP-dependent protein kinase alpha-catalytic subunit | cAMP-dependent protein kinase, alpha-catalytic subunit |
Type: | Enzyme Complex |
Mol. Mass.: | 40627.77 |
Organism: | Bos taurus (bovine) |
Description: | The PKA holoenzyme purified from bovine heart, exists as an inactive tetrameric complex, which consists of a regulatory dimer associated with two catalytic subunits. It requires cAMP to activate the enzymatic reaction. |
Residue: | 351 |
Sequence: | MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
|
|
|
BDBM15022 |
---|
biotinylated kemptide |
---|
Name: | biotinylated kemptide |
Synonyms: | n/a |
Type: | Biotinylated Peptide |
Mol. Mass.: | 1353.09 |
Organism: | n/a |
Description: | n/a |
Residue: | 12 |
Sequence: | |