Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase AKT2
LigandBDBM15131
Substrate/CompetitorAKTide-2T
Meas. Tech.PKB In Vitro Enzyme Assay
pH7.2±n/a
Temperature295.15±n/a K
IC50 0.5±n/a nM
Citation Davies TGVerdonk MLGraham BSaalau-Bethell SHamlett CCMcHardy TCollins IGarrett MDWorkman PWoodhead SJJhoti HBarford D A structural comparison of inhibitor binding to PKB, PKA and PKA-PKB chimera. J Mol Biol 367:882-94 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Serine/threonine-protein kinase AKT2
Name:Serine/threonine-protein kinase AKT2
Synonyms:AKT2 | PKB beta | Protein kinase Akt-2 | Protein kinase B (Akt 2) | Protein kinase B beta (AKT2) | Protein kinase B, beta | RAC-PK-beta | RAC-alpha serine/threonine-protein kinase (AKT2) | RAC-beta serine/threonine-protein kinase | RAC-beta serine/threonine-protein kinase (AKT2) | Serine/threonine-protein kinase AKT
Type:Enzyme
Mol. Mass.:55766.64
Organism:Homo sapiens (Human)
Description:n/a
Residue:481
Sequence:
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM15131
AKTide-2T
Name:AKTide-2T
Synonyms:AKT/PKB/Rac Protein Kinase Substrate
Type:Peptide
Mol. Mass.:1719.90
Organism:n/a
Description:n/a
Residue:14
Sequence:
ARKRERTYSFGHHA