| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitogen-activated protein kinase 1 |
|---|
| Ligand | BDBM13336 |
|---|
| Substrate/Competitor | Substrate Peptide T669 |
|---|
| Meas. Tech. | Kinase Inhibition Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| IC50 | >1000000±n/a nM |
|---|
| Citation |  Wang, Z; Canagarajah, BJ; Boehm, JC; Kassisa, S; Cobb, MH; Young, PR; Abdel-Meguid, S; Adams, JL; Goldsmith, EJ Structural basis of inhibitor selectivity in MAP kinases. Structure6:1117-28 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Mitogen-activated protein kinase 1 |
|---|
| Name: | Mitogen-activated protein kinase 1 |
|---|
| Synonyms: | ERK-2 | ERT1 | Erk2 | Extracellular signal-regulated kinase 2 | MAP kinase 2 | MAPK 2 | MK01_RAT | Mapk | Mapk1 | Mitogen-activated protein kinase 2 | Prkm1 | p42-MAPK |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 41278.65 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | MAP Kinase is the rat ERK-2 isoform containing a polyhistidine tag at the N-terminus produced in
E.coli. and activated by phosphorylation with MEK1 prior to purification. |
|---|
| Residue: | 358 |
|---|
| Sequence: | MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQ
TYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLS
NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG
ILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRI
EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
|
|
|
|---|
| BDBM13336 |
|---|
| Substrate Peptide T669 |
|---|
| Name: | Substrate Peptide T669 |
|---|
| Synonyms: | epidermal growth factor receptor (EGFR) derived peptide T669 |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 2317.55 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 21 |
|---|
| Sequence: | |
|---|
Search and Browse
