Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 8
LigandBDBM347451
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Ki 7.63±n/a nM
Citation Wright DLAnderson ACVan Heyst MOnonye S Substituted tropolone derivatives and methods of use US Patent  US9790158 Publication Date 10/17/2017
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 8
Name:Histone deacetylase 8
Synonyms:HD8 | Histone deacetylase 8 (HDAC-8) | Human HDAC8
Type:Enzyme
Mol. Mass.:41749.60
Organism:Homo sapiens (Human)
Description:Q9BY41
Residue:377
Sequence:
MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPK
VASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATI
TAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLH
HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKY
YQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLI
LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPH
RIQQILNYIKGNLKHVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM347451
n/a
NameBDBM347451
Synonyms:MO-OH-NAP | US9790158, 2
TypeSmall organic molecule
Emp. Form.C17H12O2
Mol. Mass.248.276
SMILESOc1ccccc(-c2ccc3ccccc3c2)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: