Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydroorotate Dehydrogenase (DHODH) Mutant (R265A)
LigandBDBM15345
Substrate/CompetitorBDBM15346
Meas. Tech.DHODH Inhibition Assay
IC50 80±n/a nM
Citation Baldwin JMichnoff CHMalmquist NAWhite JRoth MGRathod PKPhillips MA High-throughput screening for potent and selective inhibitors of Plasmodium falciparum dihydroorotate dehydrogenase. J Biol Chem 280:21847-53 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dihydroorotate Dehydrogenase (DHODH) Mutant (R265A)
Name:Dihydroorotate Dehydrogenase (DHODH) Mutant (R265A)
Synonyms:DHOdehase | Dihydroorotate dehydrogenase homolog | Dihydroorotate oxidase | pfR265A
Type:Enzyme
Mol. Mass.:65495.77
Organism:Plasmodium falciparum
Description:n/a
Residue:569
Sequence:
MISKLKPQFMFLPKKHILSYCRKDVLNLFEQKFYYTSKRKESNNMKNESLLRLINYNRYY
NKIDSNNYYNGGKILSNDRQYIYSPLCEYKKKINDISSYVSVPFKINIRNLGTSNFVNNK
KDVLDNDYIYENIKKEKSKHKKIIFLLFVSLFGLYGFFESYNPEFFLYDIFLKFCLKYID
GEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKL
GFSFIEIGTITPRGQTGNAKPRIFADVESRSIINSCGFNNMGCDKVTENLILFRKRQEED
KLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKL
KNIILSVKEEIDNLEKNNIMNDESTYNEDNKIVEKKNNFNKNNSHMMKDAKDNFLWFNTT
KKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAK
LKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAV
QIKRELNHLLYQRGYYNLKEAIGRKHSKS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM15345
BDBM15346
NameBDBM15345
Synonyms:Asinex compound no. 1 | N-(2,4-dichlorophenyl)naphthalene-2-carboxamide
TypeSmall organic molecule
Emp. Form.C17H11Cl2NO
Mol. Mass.316.181
SMILESClc1ccc(NC(=O)c2ccc3ccccc3c2)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: