Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetp53-binding protein Mdm2
LigandBDBM223046
Substrate/Competitorn/a
Meas. Tech.FRET Assay
Temperature298.15±n/a K
IC50 0.2019±n/a nM
Commentsextracted
Citation Cammarano CMChristopher MPDinsmore CDoll RJFradera Llinas FXLi CMachacek MMartinez MNair LGPan WReutershan MHShizuka MSteinhuebel DPSun BThompson CFTrotter BWWang YYang LBogen SLVoss MEPanda JKurissery AT 2,6,7,8 substituted purines as HDM2 inhibitors US Patent  US9540377 Publication Date 1/10/2017
More Info.:Get all data from this article,  Assay Method
 
p53-binding protein Mdm2
Name:p53-binding protein Mdm2
Synonyms:Double minute 2 protein | E3 ubiquitin-protein ligase Mdm2
Type:Enzyme Catalytic Domain
Mol. Mass.:12522.24
Organism:Homo sapiens (Human)
Description:Residue 17 to 125
Residue:109
Sequence:
SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVY
CSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSEN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM223046
n/a
NameBDBM223046
Synonyms:6-{[(1r)-1- cyclobutylethyl]amino}- 7-[(trans-4- methylcyclohexyl) methyl]-8-[(3r)-3- phenylmorpholin-4- yl]-7h-purine-2- carboxylic acid | US9540377, 11.10
TypeSmall organic molecule
Emp. Form.C30H40N6O3
Mol. Mass.532.677
SMILESC[C@@H](Nc1nc(nc2nc(N3CCOC[C@H]3c3ccccc3)n(C[C@H]3CC[C@H](C)CC3)c12)C(O)=O)C1CCC1 |r,wU:1.0,27.29,wD:24.25,15.16,(-5.24,-1.96,;-3.91,-2.73,;-2.57,-1.96,;-2.57,-.42,;-3.91,.35,;-3.91,1.89,;-2.57,2.66,;-1.24,1.89,;.23,2.36,;1.13,1.12,;2.67,1.12,;3.44,-.22,;4.98,-.22,;5.75,1.12,;4.98,2.45,;3.44,2.45,;2.67,3.78,;3.44,5.12,;2.67,6.45,;1.13,6.45,;.36,5.12,;1.13,3.78,;.23,-.13,;.62,-1.62,;2.11,-2.02,;2.51,-3.5,;4,-3.9,;5.09,-2.81,;6.57,-3.21,;4.69,-1.32,;3.2,-.93,;-1.24,.35,;-5.24,2.66,;-6.57,1.89,;-5.24,4.2,;-3.91,-4.27,;-5,-5.36,;-3.91,-6.45,;-2.82,-5.36,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: