Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 10
LigandBDBM15626
Substrate/CompetitorEGF receptor peptide
Meas. Tech.Enzyme Inhibition Assay
Ki 840±n/a nM
Citation Aronov AMBaker CBemis GWCao JChen GFord PJGermann UAGreen JHale MRJacobs MJanetka JWMaltais FMartinez-Botella GNamchuk MNStraub JTang QXie X Flipped out: structure-guided design of selective pyrazolylpyrrole ERK inhibitors. J Med Chem 50:1280-7 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Mitogen-activated protein kinase 10
Name:Mitogen-activated protein kinase 10/Receptor-interacting serine/threonine-protein kinase 1
Synonyms:JNK2/JNK3 | MAP kinase p49 3F12 | Mitogen-Activated Protein Kinase 10 (JNK3) | Mitogen-activated protein kinase 10 | Mitogen-activated protein kinase 10 (Stress-activated protein kinase JNK3) (c-Jun N-terminal kinase 3) (MAP kinase p49 3F12). | Stress-activated protein kinase JNK3 | c-Jun N-terminal kinase 3 (JNK3)
Type:Enzyme
Mol. Mass.:52586.89
Organism:Homo sapiens (Human)
Description:n/a
Residue:464
Sequence:
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM15626
EGF receptor peptide
Name:EGF receptor peptide
Synonyms:Epidermal Growth Factor Receptor Peptide (EGFRP)
Type:Peptide
Mol. Mass.:2318.63
Organism:n/a
Description:n/a
Residue:21
Sequence:
KRELVEPLTPSGEAPNQALLR