Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 10
LigandBDBM15939
Substrate/Competitorbiotinylated GST-ATF2
Meas. Tech.Kinase Selectivity Assay
Ki 72±n/a nM
Citation Szczepankiewicz BGKosogof CNelson LTLiu GLiu BZhao HSerby MDXin ZLiu MGum RJHaasch DLWang SClampit JEJohnson EFLubben THStashko MAOlejniczak ETSun CDorwin SAHaskins KAbad-Zapatero CFry EHHutchins CWSham HLRondinone CMTrevillyan JM Aminopyridine-based c-Jun N-terminal kinase inhibitors with cellular activity and minimal cross-kinase activity. J Med Chem 49:3563-80 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Mitogen-activated protein kinase 10
Name:Mitogen-activated protein kinase 10/Receptor-interacting serine/threonine-protein kinase 1
Synonyms:JNK2/JNK3 | MAP kinase p49 3F12 | Mitogen-Activated Protein Kinase 10 (JNK3) | Mitogen-activated protein kinase 10 | Mitogen-activated protein kinase 10 (Stress-activated protein kinase JNK3) (c-Jun N-terminal kinase 3) (MAP kinase p49 3F12). | Stress-activated protein kinase JNK3 | c-Jun N-terminal kinase 3 (JNK3)
Type:Enzyme
Mol. Mass.:52586.89
Organism:Homo sapiens (Human)
Description:n/a
Residue:464
Sequence:
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM15939
biotinylated GST-ATF2
Name:biotinylated GST-ATF2
Synonyms:ATF-2-GST | ATF2 | Activating transcription factor 2 | Activating transcription factor 2-GST fusion | GST-ATF2 | biotinylated ATF2 substrate | biotinylated Activating transcription factor 2 | biotinylated activating transcription factor 2
Type:Other Protein Type
Mol. Mass.:12237.77
Organism:Homo sapiens (Human)
Description:n/a
Residue:109
Sequence:
MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN
CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: